- APRIN Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90121
- APRIN
- This antibody was developed against Recombinant Protein corresponding to amino acids: ESPESSAIES TQSTPQKGRG RPSKTPSPSQ PKKNVRVGRS KQAATKENDS SEEVDVFQGS SPVDDIPQEE TEEEEVSTVN VRRRSAKRER
- APRIN, AS3, CG008
- PBS (pH 7.2) and 40% Glycerol
- Human
- 0.1 ml (also 25ul)
- Unconjugated
- Rabbit
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PDS5 cohesin associated factor B
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Apoptosis, Cell Cycle and Replication, DNA Repair
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ESPESSAIESTQSTPQKGRGRPSKTPSPSQPKKNVRVGRSKQAATKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRRSAKRER
Specifications/Features
Available conjugates: Unconjugated